PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR04G13880.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family bZIP
Protein Properties Length: 169aa    MW: 18183.3 Da    PI: 4.448
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR04G13880.2genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_136.79e-12120167552
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleel 52 
                      kr++r   NR +A rs +RK  +i+eLe+kv++L++e ++L  +l++l
  LPERR04G13880.2 120 KRAKRILANRQSAARSKERKMRYIAELERKVQTLQTEATTLSAQLSML 167
                      9*****************************************999988 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.5E-6116168IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.381118169IPR004827Basic-leucine zipper domain
PfamPF001705.8E-10120167IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.7E-11120168No hitNo description
SuperFamilySSF579593.15E-11120168No hitNo description
CDDcd147031.76E-22121168No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 169 aa     Download sequence    Send to blast
MDPAASTSAA ESSRDVVAAM PDSPPRRAAR HRRAQSEILL GAALPDDIGF DADLGVVGEV  60
GGGGDDYEEE EDEDYDEEGA GGSRMFEMFL EAGGKLEMGA DAKKAISDAK LAELALVDPK  120
RAKRILANRQ SAARSKERKM RYIAELERKV QTLQTEATTL SAQLSMLQP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAL6066276e-83AL606627.3 Oryza sativa genomic DNA, chromosome 4, BAC clone: OSJNBa0067K08, complete sequence.
GenBankAP0149606e-83AP014960.1 Oryza sativa Japonica Group DNA, chromosome 4, cultivar: Nipponbare, complete sequence.
GenBankCR8551966e-83CR855196.1 Oryza sativa genomic DNA, chromosome 4, BAC clone: OSIGBa0159F11, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001168405.12e-66uncharacterized protein LOC100382174
SwissprotQ040881e-41POF21_ARATH; Probable transcription factor PosF21
TrEMBLA0A0D9W6N81e-117A0A0D9W6N8_9ORYZ; Uncharacterized protein
TrEMBLA0A0D9W6N71e-116A0A0D9W6N7_9ORYZ; Uncharacterized protein
STRINGGRMZM2G112483_P019e-65(Zea mays)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06070.13e-35bZIP family protein